PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID estExt_fgenesh1_pm.C_50143
Common NameCOCSUDRAFT_53049
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Trebouxiophyceae; Trebouxiophyceae incertae sedis; Coccomyxaceae; Coccomyxa; Coccomyxa subellipsoidea
Family NF-YB
Protein Properties Length: 149aa    MW: 16517.8 Da    PI: 4.681
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
estExt_fgenesh1_pm.C_50143genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB65.21.3e-20294496
                       NF-YB  4 qdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylk 88
                                +d  lP a v +i+k++lP++ +++ ++ +++ +c  efi +v sea+  +++ekr tin++ ++ al +lGf   +e ++v+lk
  estExt_fgenesh1_pm.C_50143  2 EDVSLPRATVEKIVKEILPKDIRLATNTLDLLLDCCGEFIQLVYSEANTVSEEEKRSTINPEHVVRALDSLGFSSLLEDVNVFLK 86
                                5789********************************************************************************* PP

                       NF-YB 89 kyrelege 96
                                + ++++++
  estExt_fgenesh1_pm.C_50143 87 EVKDTDQK 94
                                99998776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471131.27E-302132IPR009072Histone-fold
Gene3DG3DSA:1.10.20.105.7E-342130IPR009072Histone-fold
PfamPF008085.2E-14569IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 149 aa     Download sequence    Send to blast
MEDVSLPRAT VEKIVKEILP KDIRLATNTL DLLLDCCGEF IQLVYSEANT VSEEEKRSTI  60
NPEHVVRALD SLGFSSLLED VNVFLKEVKD TDQKRSLKRH DSKAAEQNKM SEEEQIALQK  120
KLFAEARART LSCALPDAAV NSEMPGTA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_B8e-28212712133Transcription Regulator NC2 beta chain
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_005649265.11e-104DR1-like protein
TrEMBLI0Z2521e-104I0Z252_9CHLO; DR1-like protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP24221515
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23090.41e-35nuclear factor Y, subunit B13
Publications ? help Back to Top
  1. Blanc G, et al.
    The genome of the polar eukaryotic microalga Coccomyxa subellipsoidea reveals traits of cold adaptation.
    Genome Biol., 2012. 13(5): p. R39
    [PMID:22630137]